Lineage for d4apbd_ (4apb D:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2010255Fold a.127: L-aspartase-like [48556] (1 superfamily)
    multihelical, consists of three all-alpha domains
  4. 2010256Superfamily a.127.1: L-aspartase-like [48557] (3 families) (S)
  5. 2010426Family a.127.1.0: automated matches [191431] (1 protein)
    not a true family
  6. 2010427Protein automated matches [190621] (20 species)
    not a true protein
  7. 2010473Species Mycobacterium tuberculosis [TaxId:83332] [225923] (5 PDB entries)
  8. 2010481Domain d4apbd_: 4apb D: [219096]
    automated match to d1vdka_
    complexed with ca, fum

Details for d4apbd_

PDB Entry: 4apb (more details), 1.94 Å

PDB Description: Crystal structure of Mycobacterium tuberculosis fumarase (Rv1098c) S318C in complex with fumarate
PDB Compounds: (D:) fumarate hydratase class II

SCOPe Domain Sequences for d4apbd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4apbd_ a.127.1.0 (D:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
nyriehdtmgevrvpakalwraqtqravenfpisgrglertqiralgllkgacaqvnsdl
gllapekadaiiaaaaeiadgqhddqfpidvfqtgsgtssnmntneviasiaakggvtlh
pnddvnmsqssndtfptathiaateaavahlipalqqlhdalaakaldwhtvvksgrthl
mdavpvtlgqefsgyarqieagiervraclprlgelaiggtavgtglnapddfgvrvvav
lvaqtglselrtaansfeaqaardglveasgalrtiavsltkiandirwmgsgpltglae
iqlpdlqpgcsimpgkvnpvlpeavtqvaaqvigndaaiawggangafelnvyipmmarn
ilesfklltnvsrlfaqrciagltanvehlrrlaesspsivtplnsaigyeeaaavakqa
lkerktirqtvidrgligdrlsiedldrrldvlamakaeqld

SCOPe Domain Coordinates for d4apbd_:

Click to download the PDB-style file with coordinates for d4apbd_.
(The format of our PDB-style files is described here.)

Timeline for d4apbd_: