Class b: All beta proteins [48724] (180 folds) |
Fold b.85: beta-clip [51268] (7 superfamilies) double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll |
Superfamily b.85.4: dUTPase-like [51283] (2 families) forms tight trimer through an additional beta-sheet in each subunit subunit beta-sheets are orthogonally packed around the three-fold axis |
Family b.85.4.0: automated matches [191644] (1 protein) not a true family |
Protein automated matches [191182] (20 species) not a true protein |
Species Bacillus subtilis [TaxId:1423] [189439] (11 PDB entries) |
Domain d4aozc_: 4aoz C: [219088] automated match to d4apza_ complexed with act, cl, dur, mg, pop |
PDB Entry: 4aoz (more details), 2.05 Å
SCOPe Domain Sequences for d4aozc_:
Sequence, based on SEQRES records: (download)
>d4aozc_ b.85.4.0 (C:) automated matches {Bacillus subtilis [TaxId: 1423]} tmqikikyldetqtriskieqgdwidlraaedvtikkdefklvplgvamelpegyeahvv prsstyknfgviqtnsmgvidesykgdndfwffpayalrdteikkgdricqfrimkkmpa velvevehlgnedrgglgstgtk
>d4aozc_ b.85.4.0 (C:) automated matches {Bacillus subtilis [TaxId: 1423]} tmqikikyldetqtrieqgdwidlraaedvtikkdefklvplgvamelpegyeahvvprs styknfgviqtnsmgvidesykgdndfwffpayalrdteikkgdricqfrimkkmpavel vevehlgnedrgglgstgtk
Timeline for d4aozc_: