Lineage for d1cf1a2 (1cf1 A:183-393)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 937486Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 938102Family b.1.18.11: Arrestin/Vps26-like [81291] (1 protein)
  6. 938103Protein Arrestin [49244] (2 species)
    duplication: contains tandem repeat of two elaborated Ig-like domains contacting each other head-to-head
  7. 938115Species Cow (Bos taurus), visual arrestin [TaxId:9913] [49245] (2 PDB entries)
  8. 938117Domain d1cf1a2: 1cf1 A:183-393 [21908]

Details for d1cf1a2

PDB Entry: 1cf1 (more details), 2.8 Å

PDB Description: arrestin from bovine rod outer segments
PDB Compounds: (A:) protein (arrestin)

SCOPe Domain Sequences for d1cf1a2:

Sequence, based on SEQRES records: (download)

>d1cf1a2 b.1.18.11 (A:183-393) Arrestin {Cow (Bos taurus), visual arrestin [TaxId: 9913]}
dmgpqpraeaswqffmsdkplrlavslskeiyyhgepipvtvavtnstektvkkikvlve
qvtnvvlyssdyyiktvaaeeaqekvppnssltktltlvpllannrerrgialdgkikhe
dtnlasstiikegidktvmgilvsyqikvkltvsgllgeltssevatevpfrlmhpqped
pdtakesfqdenfvfeefarqnlkdageyke

Sequence, based on observed residues (ATOM records): (download)

>d1cf1a2 b.1.18.11 (A:183-393) Arrestin {Cow (Bos taurus), visual arrestin [TaxId: 9913]}
dmgpqpraeaswqffmsdkplrlavslskeiyyhgepipvtvavtnstektvkkikvlve
qvtnvvlyssdyyiktvaaeeaqekvppnssltktltlvpllannrerrgialdgkikhe
dtnlasstiikegidktvmgilvsyqikvkltvsgllgeltssevatevpfrlmhpqped
nfvfeefarqnlkdageyke

SCOPe Domain Coordinates for d1cf1a2:

Click to download the PDB-style file with coordinates for d1cf1a2.
(The format of our PDB-style files is described here.)

Timeline for d1cf1a2: