Lineage for d4anka_ (4ank A:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1301408Fold b.3: Prealbumin-like [49451] (7 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 1301610Superfamily b.3.4: Transthyretin (synonym: prealbumin) [49472] (2 families) (S)
  5. 1301611Family b.3.4.1: Transthyretin (synonym: prealbumin) [49473] (2 proteins)
    automatically mapped to Pfam PF00576
  6. 1302067Protein automated matches [190376] (1 species)
    not a true protein
  7. 1302068Species Human (Homo sapiens) [TaxId:9606] [187223] (5 PDB entries)
  8. 1302071Domain d4anka_: 4ank A: [219079]
    automated match to d1tlma_

Details for d4anka_

PDB Entry: 4ank (more details), 1.7 Å

PDB Description: crystallographic study of novel transthyretin ligands exhibiting negative-cooperativity between two t4 binding sites.
PDB Compounds: (A:) Transthyretin

SCOPe Domain Sequences for d4anka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4anka_ b.3.4.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
kveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtnp

SCOPe Domain Coordinates for d4anka_:

Click to download the PDB-style file with coordinates for d4anka_.
(The format of our PDB-style files is described here.)

Timeline for d4anka_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4ankb_