![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.78: ATC-like [53670] (2 superfamilies) consists of two similar domains related by pseudo dyad; duplication core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134 |
![]() | Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families) ![]() |
![]() | Family c.78.1.0: automated matches [227206] (1 protein) not a true family |
![]() | Protein automated matches [226938] (26 species) not a true protein |
![]() | Species Mycoplasma penetrans [TaxId:28227] [226338] (2 PDB entries) |
![]() | Domain d4anfb1: 4anf B:1-153 [219072] automated match to d1duvg1 |
PDB Entry: 4anf (more details), 2.6 Å
SCOPe Domain Sequences for d4anfb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4anfb1 c.78.1.0 (B:1-153) automated matches {Mycoplasma penetrans [TaxId: 28227]} mpvnlkgrsldsllnftteevqhlidlsidlkkakyqglhinnrplvgkniailfqkdst rtrcafevaasdlgagvtyigpsgsnmgkkesiedtakvlgrfydgiefrgfaqsdvdal vkysgvpvwngltddehptqiiadfmtmkekfg
Timeline for d4anfb1: