Lineage for d4anfb1 (4anf B:1-153)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2906432Fold c.78: ATC-like [53670] (2 superfamilies)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134
  4. 2906433Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families) (S)
  5. 2906884Family c.78.1.0: automated matches [227206] (1 protein)
    not a true family
  6. 2906885Protein automated matches [226938] (26 species)
    not a true protein
  7. 2907148Species Mycoplasma penetrans [TaxId:28227] [226338] (2 PDB entries)
  8. 2907159Domain d4anfb1: 4anf B:1-153 [219072]
    automated match to d1duvg1

Details for d4anfb1

PDB Entry: 4anf (more details), 2.6 Å

PDB Description: Structure of the ornithine carbamoyltransferase from Mycoplasma penetrans with a P23 Space group
PDB Compounds: (B:) ornithine carbamoyltransferase, catabolic

SCOPe Domain Sequences for d4anfb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4anfb1 c.78.1.0 (B:1-153) automated matches {Mycoplasma penetrans [TaxId: 28227]}
mpvnlkgrsldsllnftteevqhlidlsidlkkakyqglhinnrplvgkniailfqkdst
rtrcafevaasdlgagvtyigpsgsnmgkkesiedtakvlgrfydgiefrgfaqsdvdal
vkysgvpvwngltddehptqiiadfmtmkekfg

SCOPe Domain Coordinates for d4anfb1:

Click to download the PDB-style file with coordinates for d4anfb1.
(The format of our PDB-style files is described here.)

Timeline for d4anfb1: