SCOPe 2.05: Domain d4anfa1: 4anf A:1-153

Lineage for d4anfa1 (4anf A:1-153)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.78: ATC-like [53670] (2 superfamilies)
   consists of two similar domains related by pseudo dyad; duplication
   core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families)

5. Family c.78.1.0: automated matches [227206] (1 protein)
   not a true family

6. Protein automated matches [226938] (22 species)
   not a true protein

7. Species Mycoplasma penetrans [TaxId:28227] [226338] (2 PDB entries)

8. Domain d4anfa1: 4anf A:1-153 [219070]
   automated match to d1duvg1

Details for d4anfa1

PDB Entry: 4anf, 2.6 Å

PDB Description: Structure of the ornithine carbamoyltransferase from Mycoplasma penetrans with a P23 Space group

PDB Compounds: (A:) ornithine carbamoyltransferase, catabolic

SCOPe Domain Sequences for d4anfa1:

Sequence; same for both SEQRES and ATOM records:

>d4anfa1 c.78.1.0 (A:1-153) automated matches {Mycoplasma penetrans [TaxId: 28227]}
mpvnlkgrsldsllnftteevqhlidlsidlkkakyqglhinnrplvgkniailfqkdst
rtrcafevaasdlgagvtyigpsgsnmgkkesiedtakvlgrfydgiefrgfaqsdvdal
vkysgvpvwngltddehptqiiadfmtmkekfg

Timeline for d4anfa1:

• d4anfa1 first appeared in SCOPe 2.03
  
• d4anfa1 appears in SCOPe 2.04
  
• d4anfa1 appears in SCOPe 2.06
  
• d4anfa1 appears in the current release, SCOPe 2.08