SCOPe 2.04: Domain d4an0a1: 4an0 A:1-430

Lineage for d4an0a1 (4an0 A:1-430)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.69: 7-bladed beta-propeller [50964] (14 superfamilies)
   consists of seven 4-stranded beta-sheet motifs; meander

4. Superfamily b.69.7: Peptidase/esterase 'gauge' domain [50993] (3 families)

5. Family b.69.7.1: Prolyl oligopeptidase, N-terminal domain [50994] (2 proteins)
   automatically mapped to Pfam PF02897

6. Protein Prolyl oligopeptidase, N-terminal domain [50995] (1 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [50996] (27 PDB entries)
   Uniprot P23687

8. Domain d4an0a1: 4an0 A:1-430 [219066]
   Other proteins in same PDB: d4an0a2
   automated match to d1qfma1
   complexed with 2p6, gol

Details for d4an0a1

PDB Entry: 4an0, 2.2 Å

PDB Description: prolyl oligopeptidase from porcine brain with a covalently bound inhibitor ic-3

PDB Compounds: (A:) prolyl endopeptidase

SCOPe Domain Sequences for d4an0a1:

Sequence; same for both SEQRES and ATOM records:

>d4an0a1 b.69.7.1 (A:1-430) Prolyl oligopeptidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}
mlsfqypdvyrdetaiqdyhghkvcdpyawledpdseqtkafveaqnkitvpfleqcpir
glykermtelydypkyschfkkgkryfyfyntglqnqrvlyvqdslegearvfldpnils
ddgtvalrgyafsedgeyfayglsasgsdwvtikfmkvdgakelpdvlervkfscmawth
dgkgmfynaypqqdgksdgtetstnlhqklyyhvlgtdqsedilcaefpdepkwmggael
sddgryvllsiregcdpvnrlwycdlqqesngitgilkwvklidnfegeydyvtnegtvf
tfktnrhspnyrlinidftdpeeskwkvlvpehekdvlewvacvrsnflvlcylhdvknt
lqlhdlatgallkifplevgsvvgysgqkkdteifyqftsflspgiiyhcdltkeelepr
vfrevtvkgi

Timeline for d4an0a1:

• d4an0a1 first appeared in SCOPe 2.03
  
• d4an0a1 appears in SCOPe 2.05
  
• d4an0a1 appears in the current release, SCOPe 2.08