Lineage for d4amya1 (4amy A:1-430)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2065823Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 2066277Superfamily b.69.7: Peptidase/esterase 'gauge' domain [50993] (3 families) (S)
  5. 2066278Family b.69.7.1: Prolyl oligopeptidase, N-terminal domain [50994] (2 protein domains)
    automatically mapped to Pfam PF02897
  6. 2066279Protein Prolyl oligopeptidase, N-terminal domain [50995] (1 species)
  7. 2066280Species Pig (Sus scrofa) [TaxId:9823] [50996] (27 PDB entries)
    Uniprot P23687
  8. 2066301Domain d4amya1: 4amy A:1-430 [219062]
    Other proteins in same PDB: d4amya2
    automated match to d1qfma1
    complexed with 2p2, gol

Details for d4amya1

PDB Entry: 4amy (more details), 2 Å

PDB Description: prolyl oligopeptidase from porcine brain with a covalently bound inhibitor ic-1
PDB Compounds: (A:) prolyl endopeptidase

SCOPe Domain Sequences for d4amya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4amya1 b.69.7.1 (A:1-430) Prolyl oligopeptidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}
mlsfqypdvyrdetaiqdyhghkvcdpyawledpdseqtkafveaqnkitvpfleqcpir
glykermtelydypkyschfkkgkryfyfyntglqnqrvlyvqdslegearvfldpnils
ddgtvalrgyafsedgeyfayglsasgsdwvtikfmkvdgakelpdvlervkfscmawth
dgkgmfynaypqqdgksdgtetstnlhqklyyhvlgtdqsedilcaefpdepkwmggael
sddgryvllsiregcdpvnrlwycdlqqesngitgilkwvklidnfegeydyvtnegtvf
tfktnrhspnyrlinidftdpeeskwkvlvpehekdvlewvacvrsnflvlcylhdvknt
lqlhdlatgallkifplevgsvvgysgqkkdteifyqftsflspgiiyhcdltkeelepr
vfrevtvkgi

SCOPe Domain Coordinates for d4amya1:

Click to download the PDB-style file with coordinates for d4amya1.
(The format of our PDB-style files is described here.)

Timeline for d4amya1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4amya2