SCOPe 2.08: Domain d4amvc1: 4amv C:241-608

Lineage for d4amvc1 (4amv C:241-608)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.80: SIS domain [53696] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 5 strands, order 21345

4. Superfamily c.80.1: SIS domain [53697] (4 families)

5. Family c.80.1.1: double-SIS domain [53698] (5 proteins)
   duplication: consists of two SIS domains related by pseudo dyad

6. Protein 'Isomerase domain' of glucosamine 6-phosphate synthase (GLMS) [53699] (2 species)

7. Species Escherichia coli [TaxId:562] [53700] (6 PDB entries)

8. Domain d4amvc1: 4amv C:241-608 [219060]
   Other proteins in same PDB: d4amva2, d4amvb2, d4amvc2
   complexed with f6r

Details for d4amvc1

PDB Entry: 4amv, 2.05 Å

PDB Description: e.coli glucosamine-6p synthase in complex with fructose-6p

PDB Compounds: (C:) glucosamine--fructose-6-phosphate aminotransferase [isomer izing]

SCOPe Domain Sequences for d4amvc1:

Sequence; same for both SEQRES and ATOM records:

>d4amvc1 c.80.1.1 (C:241-608) 'Isomerase domain' of glucosamine 6-phosphate synthase (GLMS) {Escherichia coli [TaxId: 562]}
dagdkgiyrhymqkeiyeqpnaikntltgrishgqvdlselgpnadellskvehiqilac
gtsynsgmvsrywfeslagipcdveiasefryrksavrrnslmitlsqsgetadtlaglr
lskelgylgslaicnvpgsslvresdlalmtnagteigvastkafttqltvllmlvakls
klkgldasiehdivhglqalpsrieqmlsqdkriealaedfsdkhhalflgrgdqypial
egalklkeisyihaeayaagelkhgplalidadmpvivvapnnelleklksnieevrarg
gqlyvfadqdagfvssdnmhiiemphveeviapifytvplqllayhvalikgtdvdqprn
laksvtve

Timeline for d4amvc1:

• d4amvc1 first appeared in SCOPe 2.03
  
• d4amvc1 appears in SCOPe 2.07