Class b: All beta proteins [48724] (165 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (20 families) "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
Family b.1.18.8: RhoGDI-like [81288] (2 proteins) |
Protein Rho GDP-dissociation inhibitor 1, RhoGDI [49241] (2 species) |
Species Cow (Bos taurus) [TaxId:9913] [49243] (4 PDB entries) |
Domain d1gdfa_: 1gdf A: [21906] |
PDB Entry: 1gdf (more details)
SCOP Domain Sequences for d1gdfa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gdfa_ b.1.18.8 (A:) Rho GDP-dissociation inhibitor 1, RhoGDI {Cow (Bos taurus) [TaxId: 9913]} avsadpnvpnvvvtrltlvcstapgpleldltgdlesfkkqsfvlkegveyrikisfrvn reivsgmkyiqhtyrkgvkidktdymvgsygpraeeyefltpmeeapkgmlargsyniks rftdddrtdhlswewnltikkewkd
Timeline for d1gdfa_: