SCOPe 2.03: Domain d4amuc1: 4amu C:-1-153

Lineage for d4amuc1 (4amu C:-1-153)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.78: ATC-like [53670] (2 superfamilies)
   consists of two similar domains related by pseudo dyad; duplication
   core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families)

5. Family c.78.1.0: automated matches [227206] (1 protein)
   not a true family

6. Protein automated matches [226938] (20 species)
   not a true protein

7. Species Mycoplasma penetrans [TaxId:28227] [226338] (2 PDB entries)

8. Domain d4amuc1: 4amu C:-1-153 [219052]
   automated match to d1duvg1

Details for d4amuc1

PDB Entry: 4amu, 2.5 Å

PDB Description: Structure of ornithine carbamoyltransferase from Mycoplasma penetrans with a P321 space group

PDB Compounds: (C:) ornithine carbamoyltransferase, catabolic

SCOPe Domain Sequences for d4amuc1:

Sequence; same for both SEQRES and ATOM records:

>d4amuc1 c.78.1.0 (C:-1-153) automated matches {Mycoplasma penetrans [TaxId: 28227]}
khmpvnlkgrsldsllnftteevqhlidlsidlkkakyqglhinnrplvgkniailfqkd
strtrcafevaasdlgagvtyigpsgsnmgkkesiedtakvlgrfydgiefrgfaqsdvd
alvkysgvpvwngltddehptqiiadfmtmkekfg

Timeline for d4amuc1:

• d4amuc1 is new in SCOPe 2.03-stable
  
• d4amuc1 appears in SCOPe 2.04
  
• d4amuc1 appears in the current release, SCOPe 2.08