Lineage for d4amuc1 (4amu C:-1-153)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1386472Fold c.78: ATC-like [53670] (2 superfamilies)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134
  4. 1386473Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families) (S)
  5. 1386919Family c.78.1.0: automated matches [227206] (1 protein)
    not a true family
  6. 1386920Protein automated matches [226938] (20 species)
    not a true protein
  7. 1387026Species Mycoplasma penetrans [TaxId:28227] [226338] (2 PDB entries)
  8. 1387031Domain d4amuc1: 4amu C:-1-153 [219052]
    automated match to d1duvg1

Details for d4amuc1

PDB Entry: 4amu (more details), 2.5 Å

PDB Description: Structure of ornithine carbamoyltransferase from Mycoplasma penetrans with a P321 space group
PDB Compounds: (C:) ornithine carbamoyltransferase, catabolic

SCOPe Domain Sequences for d4amuc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4amuc1 c.78.1.0 (C:-1-153) automated matches {Mycoplasma penetrans [TaxId: 28227]}
khmpvnlkgrsldsllnftteevqhlidlsidlkkakyqglhinnrplvgkniailfqkd
strtrcafevaasdlgagvtyigpsgsnmgkkesiedtakvlgrfydgiefrgfaqsdvd
alvkysgvpvwngltddehptqiiadfmtmkekfg

SCOPe Domain Coordinates for d4amuc1:

Click to download the PDB-style file with coordinates for d4amuc1.
(The format of our PDB-style files is described here.)

Timeline for d4amuc1: