![]() | Class b: All beta proteins [48724] (177 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.18: E set domains [81296] (24 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
![]() | Family b.1.18.8: RhoGDI-like [81288] (3 proteins) |
![]() | Protein Rho GDP-dissociation inhibitor 1, RhoGDI [49241] (3 species) |
![]() | Domain d1ajwa_: 1ajw A: [21905] |
PDB Entry: 1ajw (more details)
SCOPe Domain Sequences for d1ajwa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ajwa_ b.1.18.8 (A:) Rho GDP-dissociation inhibitor 1, RhoGDI {Cow (Bos taurus) [TaxId: 9913]} avsadpnvpnvvvtrltlvcstapgpleldltgdlesfkkqsfvlkegveyrikisfrvn reivsgmkyiqhtyrkgvkidktdymvgsygpraeeyefltpmeeapkgmlargsyniks rftdddrtdhlswewnltikkewkd
Timeline for d1ajwa_: