Lineage for d1ajwa_ (1ajw A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1770169Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 1770659Family b.1.18.8: RhoGDI-like [81288] (3 proteins)
  6. 1770677Protein Rho GDP-dissociation inhibitor 1, RhoGDI [49241] (3 species)
  7. Species Cow (Bos taurus) [TaxId:9913] [49243] (3 PDB entries)
  8. 1770680Domain d1ajwa_: 1ajw A: [21905]

Details for d1ajwa_

PDB Entry: 1ajw (more details)

PDB Description: structure of rhogdi: a c-terminal binding domain targets an n-terminal inhibitory peptide to gtpases, nmr, 20 structures
PDB Compounds: (A:) rhogdi

SCOPe Domain Sequences for d1ajwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ajwa_ b.1.18.8 (A:) Rho GDP-dissociation inhibitor 1, RhoGDI {Cow (Bos taurus) [TaxId: 9913]}
avsadpnvpnvvvtrltlvcstapgpleldltgdlesfkkqsfvlkegveyrikisfrvn
reivsgmkyiqhtyrkgvkidktdymvgsygpraeeyefltpmeeapkgmlargsyniks
rftdddrtdhlswewnltikkewkd

SCOPe Domain Coordinates for d1ajwa_:

Click to download the PDB-style file with coordinates for d1ajwa_.
(The format of our PDB-style files is described here.)

Timeline for d1ajwa_: