SCOP 1.71: Domain d1ajw__: 1ajw -

Lineage for d1ajw__ (1ajw -)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (18 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.8: RhoGDI-like [81288] (2 proteins)

6. Protein Rho GDP-dissociation inhibitor 1, RhoGDI [49241] (2 species)

7. Species Cow (Bos taurus) [TaxId:9913] [49243] (4 PDB entries)

8. Domain d1ajw__: 1ajw - [21905]

Details for d1ajw__

PDB Entry: 1ajw

PDB Description: structure of rhogdi: a c-terminal binding domain targets an n-terminal inhibitory peptide to gtpases, nmr, 20 structures

SCOP Domain Sequences for d1ajw__:

Sequence; same for both SEQRES and ATOM records:

>d1ajw__ b.1.18.8 (-) Rho GDP-dissociation inhibitor 1, RhoGDI {Cow (Bos taurus)}
avsadpnvpnvvvtrltlvcstapgpleldltgdlesfkkqsfvlkegveyrikisfrvn
reivsgmkyiqhtyrkgvkidktdymvgsygpraeeyefltpmeeapkgmlargsyniks
rftdddrtdhlswewnltikkewkd

Timeline for d1ajw__:

• d1ajw__ first appeared (with stable ids) in SCOP 1.55
  
• d1ajw__ appears in SCOP 1.69
  
• d1ajw__ is called d1ajwa_ in SCOP 1.73
  
• d1ajw__ appears in the current release, SCOPe 2.08, called d1ajwa_