Lineage for d1ajw__ (1ajw -)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 450778Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 456110Superfamily b.1.18: E set domains [81296] (18 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 456451Family b.1.18.8: RhoGDI-like [81288] (2 proteins)
  6. 456457Protein Rho GDP-dissociation inhibitor 1, RhoGDI [49241] (2 species)
  7. 456458Species Cow (Bos taurus) [TaxId:9913] [49243] (4 PDB entries)
  8. 456464Domain d1ajw__: 1ajw - [21905]

Details for d1ajw__

PDB Entry: 1ajw (more details)

PDB Description: structure of rhogdi: a c-terminal binding domain targets an n-terminal inhibitory peptide to gtpases, nmr, 20 structures

SCOP Domain Sequences for d1ajw__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ajw__ b.1.18.8 (-) Rho GDP-dissociation inhibitor 1, RhoGDI {Cow (Bos taurus)}
avsadpnvpnvvvtrltlvcstapgpleldltgdlesfkkqsfvlkegveyrikisfrvn
reivsgmkyiqhtyrkgvkidktdymvgsygpraeeyefltpmeeapkgmlargsyniks
rftdddrtdhlswewnltikkewkd

SCOP Domain Coordinates for d1ajw__:

Click to download the PDB-style file with coordinates for d1ajw__.
(The format of our PDB-style files is described here.)

Timeline for d1ajw__: