Lineage for d1ajw__ (1ajw -)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) 
Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.5: E set domains [49208] (23 proteins) 
Protein Rho GDP-dissociation inhibitor 1, RhoGDI [49241] (2 species) 
Species Cow (Bos taurus) [TaxId:9913] [49243] (3 PDB entries) 
Domain d1ajw__: 1ajw - [21905]
Details for d1ajw__
PDB Entry: 1ajw (more details)
PDB Description: structure of rhogdi: a c-terminal binding domain targets an n-terminal inhibitory peptide to gtpases, nmr, 20 structures
SCOP Domain Sequences for d1ajw__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ajw__ b.1.1.5 (-) Rho GDP-dissociation inhibitor 1, RhoGDI {Cow (Bos taurus)}
avsadpnvpnvvvtrltlvcstapgpleldltgdlesfkkqsfvlkegveyrikisfrvn
reivsgmkyiqhtyrkgvkidktdymvgsygpraeeyefltpmeeapkgmlargsyniks
rftdddrtdhlswewnltikkewkd
SCOP Domain Coordinates for d1ajw__:
Click to download the PDB-style file with coordinates for d1ajw__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ajw__:
- d1ajw__ appears in SCOP 1.57
- d1ajw__ appears in the current release, SCOPe 2.08, called d1ajwa_
View in 3D