Class g: Small proteins [56992] (100 folds) |
Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
Superfamily g.3.1: Plant lectins/antimicrobial peptides [57016] (3 families) |
Family g.3.1.1: Hevein-like agglutinin (lectin) domain [57017] (7 proteins) |
Protein Wheat germ agglutinin (WGA) [57018] (1 species) one subunit consists of four homologous domains |
Species Wheat (Triticum aestivum), also known as Triticum vulgare [TaxId:4565] [57019] (13 PDB entries) |
Domain d4amla1: 4aml A:1-52 [219040] automated match to d2cwga1 complexed with gol, gyu |
PDB Entry: 4aml (more details), 1.6 Å
SCOPe Domain Sequences for d4amla1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4amla1 g.3.1.1 (A:1-52) Wheat germ agglutinin (WGA) {Wheat (Triticum aestivum), also known as Triticum vulgare [TaxId: 4565]} ercgeqgsnmecpnnlccsqygycgmggdycgkgcqngacwtskrcgsqagg
Timeline for d4amla1:
View in 3D Domains from other chains: (mouse over for more information) d4amlb1, d4amlb2, d4amlb3, d4amlb4 |