Lineage for d1doab_ (1doa B:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 937486Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 937950Family b.1.18.8: RhoGDI-like [81288] (3 proteins)
  6. 937961Protein Rho GDP-dissociation inhibitor 1, RhoGDI [49241] (2 species)
  7. 937962Species Cow (Bos taurus) [TaxId:9913] [49243] (4 PDB entries)
  8. 937967Domain d1doab_: 1doa B: [21904]
    Other proteins in same PDB: d1doaa_
    complexed with gdp, ger, mg

Details for d1doab_

PDB Entry: 1doa (more details), 2.6 Å

PDB Description: Structure of the rho family gtp-binding protein cdc42 in complex with the multifunctional regulator rhogdi
PDB Compounds: (B:) protein (GDP-dissociation inhibitor 1)

SCOPe Domain Sequences for d1doab_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1doab_ b.1.18.8 (B:) Rho GDP-dissociation inhibitor 1, RhoGDI {Cow (Bos taurus) [TaxId: 9913]}
eptaeqlaqiaaeneedehsvnykppaqksiqeiqeldkddeslrkykeallgrvavsad
pnvpnvvvtrltlvcstapgpleldltgdlesfkkqsfvlkegveyrikisfrvnreivs
gmkyiqhtyrkgvkidktdymvgsygpraeeyefltpmeeapkgmlargsyniksrftdd
drtdhlswewnltikkewkd

SCOPe Domain Coordinates for d1doab_:

Click to download the PDB-style file with coordinates for d1doab_.
(The format of our PDB-style files is described here.)

Timeline for d1doab_: