Lineage for d1doab_ (1doa B:)
- Root: SCOP 1.59
Class b: All beta proteins [48724] (110 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies) Superfamily b.1.1: Immunoglobulin [48726] (6 families) 
Family b.1.1.5: E set domains [49208] (25 proteins) 
Protein Rho GDP-dissociation inhibitor 1, RhoGDI [49241] (2 species) 
Species Cow (Bos taurus) [TaxId:9913] [49243] (3 PDB entries) 
Domain d1doab_: 1doa B: [21904]
Other proteins in same PDB: d1doaa_
Details for d1doab_
PDB Entry: 1doa (more details), 2.6 Å
PDB Description: Structure of the rho family gtp-binding protein cdc42 in complex with the multifunctional regulator rhogdi
SCOP Domain Sequences for d1doab_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1doab_ b.1.1.5 (B:) Rho GDP-dissociation inhibitor 1, RhoGDI {Cow (Bos taurus)}
eptaeqlaqiaaeneedehsvnykppaqksiqeiqeldkddeslrkykeallgrvavsad
pnvpnvvvtrltlvcstapgpleldltgdlesfkkqsfvlkegveyrikisfrvnreivs
gmkyiqhtyrkgvkidktdymvgsygpraeeyefltpmeeapkgmlargsyniksrftdd
drtdhlswewnltikkewkd
SCOP Domain Coordinates for d1doab_:
Click to download the PDB-style file with coordinates for d1doab_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1doab_:
- d1doab_ first appeared (with stable ids) in SCOP 1.55
- d1doab_ appears in SCOP 1.57
- d1doab_ appears in SCOP 1.61
- d1doab_ appears in the current release, SCOPe 2.08
View in 3D
