![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.18: E set domains [81296] (27 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
![]() | Family b.1.18.8: RhoGDI-like [81288] (3 proteins) |
![]() | Protein Rho GDP-dissociation inhibitor 1, RhoGDI [49241] (3 species) |
![]() | Domain d1doab_: 1doa B: [21904] Other proteins in same PDB: d1doaa1, d1doaa2 complexed with gdp, ger, mg |
PDB Entry: 1doa (more details), 2.6 Å
SCOPe Domain Sequences for d1doab_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1doab_ b.1.18.8 (B:) Rho GDP-dissociation inhibitor 1, RhoGDI {Cow (Bos taurus) [TaxId: 9913]} eptaeqlaqiaaeneedehsvnykppaqksiqeiqeldkddeslrkykeallgrvavsad pnvpnvvvtrltlvcstapgpleldltgdlesfkkqsfvlkegveyrikisfrvnreivs gmkyiqhtyrkgvkidktdymvgsygpraeeyefltpmeeapkgmlargsyniksrftdd drtdhlswewnltikkewkd
Timeline for d1doab_: