Lineage for d4amkl1 (4amk L:2-110)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1755448Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1757949Protein automated matches [190119] (18 species)
    not a true protein
  7. 1758513Species Mouse (Mus musculus) [TaxId:10090] [186842] (133 PDB entries)
  8. 1758628Domain d4amkl1: 4amk L:2-110 [219038]
    Other proteins in same PDB: d4amkl2
    automated match to d1q0xl1
    complexed with gol, mg

Details for d4amkl1

PDB Entry: 4amk (more details), 2.05 Å

PDB Description: fab fragment of antiporphrin antibody 13g10
PDB Compounds: (L:) fab13g10, light chain

SCOPe Domain Sequences for d4amkl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4amkl1 b.1.1.1 (L:2-110) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
avvtqesalttspgetvtltcrsstgavttsnyanwvqekpdhlftgliggtnnrapgvp
arfsgsligdkaaltitgaqtedeaiyfcalwysnhlvfgggtkltvlg

SCOPe Domain Coordinates for d4amkl1:

Click to download the PDB-style file with coordinates for d4amkl1.
(The format of our PDB-style files is described here.)

Timeline for d4amkl1: