SCOPe 2.03: Domain d4amha_: 4amh A:

Lineage for d4amha_ (4amh A:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.36: PDZ domain-like [50155] (1 superfamily)
   contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix

4. Superfamily b.36.1: PDZ domain-like [50156] (7 families)
   peptide-binding domain

5. Family b.36.1.0: automated matches [191362] (1 protein)
   not a true family

6. Protein automated matches [190436] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187333] (44 PDB entries)

8. Domain d4amha_: 4amh A: [219036]
   automated match to d3rl7b_
   complexed with gol, trs; mutant

Details for d4amha_

PDB Entry: 4amh, 2.3 Å

PDB Description: influence of circular permutation on the folding pathway of a pdz domain

PDB Compounds: (A:) Disks large homolog 1

SCOPe Domain Sequences for d4amha_:

Sequence; same for both SEQRES and ATOM records:

>d4amha_ b.36.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
skglgfsiaggvgnqhwpgdnsiyvtkiieggaahkdgklqigdkllavnnvaleevthe
eavtalkntsdfvylkvakpgsgekimeiklikg

Timeline for d4amha_:

• d4amha_ is new in SCOPe 2.03-stable
  
• d4amha_ appears in SCOPe 2.04
  
• d4amha_ appears in the current release, SCOPe 2.08, called d4amha1