SCOPe 2.08: Domain d4am5a_: 4am5 A:

Lineage for d4am5a_ (4am5 A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (10 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.1: Ferritin [47241] (10 proteins)

6. Protein automated matches [190041] (34 species)
   not a true protein

7. Species Blastochloris viridis [TaxId:1079] [193423] (3 PDB entries)

8. Domain d4am5a_: 4am5 A: [219034]
   automated match to d4am4b_
   complexed with fe, hem

Details for d4am5a_

PDB Entry: 4am5, 1.58 Å

PDB Description: bacterioferritin from blastochloris viridis

PDB Compounds: (A:) bacterioferritin

SCOPe Domain Sequences for d4am5a_:

Sequence; same for both SEQRES and ATOM records:

>d4am5a_ a.25.1.1 (A:) automated matches {Blastochloris viridis [TaxId: 1079]}
mkgdqkvieylnrglrseltavsqywlhyrmledwgykdlakkwraesieemahadkfve
rilfleglpnlqtldplrigqtvkevlesdlaaerearalyqegaayaasvgdfpsknlf
eelmgdeehhidfletqldlvsklglelyaqhhigkldd

Timeline for d4am5a_:

• d4am5a_ first appeared in SCOPe 2.03
  
• d4am5a_ appears in SCOPe 2.07