Lineage for d4am5a_ (4am5 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2700837Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2700838Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2700839Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 2702255Protein automated matches [190041] (34 species)
    not a true protein
  7. 2702305Species Blastochloris viridis [TaxId:1079] [193423] (3 PDB entries)
  8. 2702306Domain d4am5a_: 4am5 A: [219034]
    automated match to d4am4b_
    complexed with fe, hem

Details for d4am5a_

PDB Entry: 4am5 (more details), 1.58 Å

PDB Description: bacterioferritin from blastochloris viridis
PDB Compounds: (A:) bacterioferritin

SCOPe Domain Sequences for d4am5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4am5a_ a.25.1.1 (A:) automated matches {Blastochloris viridis [TaxId: 1079]}
mkgdqkvieylnrglrseltavsqywlhyrmledwgykdlakkwraesieemahadkfve
rilfleglpnlqtldplrigqtvkevlesdlaaerearalyqegaayaasvgdfpsknlf
eelmgdeehhidfletqldlvsklglelyaqhhigkldd

SCOPe Domain Coordinates for d4am5a_:

Click to download the PDB-style file with coordinates for d4am5a_.
(The format of our PDB-style files is described here.)

Timeline for d4am5a_: