![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
![]() | Superfamily a.25.1: Ferritin-like [47240] (10 families) ![]() contains bimetal-ion centre in the middle of the bundle |
![]() | Family a.25.1.1: Ferritin [47241] (10 proteins) |
![]() | Protein automated matches [190041] (34 species) not a true protein |
![]() | Species Blastochloris viridis [TaxId:1079] [193423] (3 PDB entries) |
![]() | Domain d4am2b_: 4am2 B: [219033] automated match to d4am4b_ complexed with fe, hem |
PDB Entry: 4am2 (more details), 1.8 Å
SCOPe Domain Sequences for d4am2b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4am2b_ a.25.1.1 (B:) automated matches {Blastochloris viridis [TaxId: 1079]} mkgdqkvieylnrglrseltavsqywlhyrmledwgykdlakkwraesieemahadkfve rilfleglpnlqtldplrigqtvkevlesdlaaerearalyqegaayaasvgdfpsknlf eelmgdeehhidfletqldlvsklglelyaqhhigkldd
Timeline for d4am2b_: