Lineage for d4am2b_ (4am2 B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2700837Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2700838Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2700839Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 2702255Protein automated matches [190041] (34 species)
    not a true protein
  7. 2702305Species Blastochloris viridis [TaxId:1079] [193423] (3 PDB entries)
  8. 2702311Domain d4am2b_: 4am2 B: [219033]
    automated match to d4am4b_
    complexed with fe, hem

Details for d4am2b_

PDB Entry: 4am2 (more details), 1.8 Å

PDB Description: bacterioferritin from blastochloris viridis
PDB Compounds: (B:) bacterioferritin

SCOPe Domain Sequences for d4am2b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4am2b_ a.25.1.1 (B:) automated matches {Blastochloris viridis [TaxId: 1079]}
mkgdqkvieylnrglrseltavsqywlhyrmledwgykdlakkwraesieemahadkfve
rilfleglpnlqtldplrigqtvkevlesdlaaerearalyqegaayaasvgdfpsknlf
eelmgdeehhidfletqldlvsklglelyaqhhigkldd

SCOPe Domain Coordinates for d4am2b_:

Click to download the PDB-style file with coordinates for d4am2b_.
(The format of our PDB-style files is described here.)

Timeline for d4am2b_: