SCOP 1.75: Domain d1cc0f_: 1cc0 F:

Lineage for d1cc0f_ (1cc0 F:)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (23 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.8: RhoGDI-like [81288] (2 proteins)

6. Protein Rho GDP-dissociation inhibitor 1, RhoGDI [49241] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49242] (11 PDB entries)

8. Domain d1cc0f_: 1cc0 F: [21903]
   Other proteins in same PDB: d1cc0a_, d1cc0c_

Details for d1cc0f_

PDB Entry: 1cc0, 5 Å

PDB Description: crystal structure of the rhoa.gdp-rhogdi complex

PDB Compounds: (F:) rho GDP dissociation inhibitor alpha

SCOP Domain Sequences for d1cc0f_:

Sequence; same for both SEQRES and ATOM records:

>d1cc0f_ b.1.18.8 (F:) Rho GDP-dissociation inhibitor 1, RhoGDI {Human (Homo sapiens) [TaxId: 9606]}
svnykppaqksiqeiqeldkddeslrkykeallgrvavsadpnvpnvvvtgltlvcssap
gpleldltgdlesfkkqsfvlkegveyrikisfrvnreivsgmkyiqhtyrkgvkidktd
ymvgsygpraeeyefltpveeapkgmlargsysiksrftdddktdhlswewnltikkdwk

Timeline for d1cc0f_:

• d1cc0f_ first appeared (with stable ids) in SCOP 1.55
  
• d1cc0f_ appears in SCOP 1.73
  
• d1cc0f_ appears in SCOPe 2.01
  
• d1cc0f_ appears in the current release, SCOPe 2.08