Lineage for d1cc0e_ (1cc0 E:)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 101938Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 104969Family b.1.1.5: E set domains [49208] (25 proteins)
  6. 105156Protein Rho GDP-dissociation inhibitor 1, RhoGDI [49241] (2 species)
  7. 105161Species Human (Homo sapiens) [TaxId:9606] [49242] (8 PDB entries)
  8. 105175Domain d1cc0e_: 1cc0 E: [21902]
    Other proteins in same PDB: d1cc0a_, d1cc0c_

Details for d1cc0e_

PDB Entry: 1cc0 (more details), 5 Å

PDB Description: crystal structure of the rhoa.gdp-rhogdi complex

SCOP Domain Sequences for d1cc0e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cc0e_ b.1.1.5 (E:) Rho GDP-dissociation inhibitor 1, RhoGDI {Human (Homo sapiens)}
svnykppaqksiqeiqeldkddeslrkykeallgrvavsadpnvpnvvvtgltlvcssap
gpleldltgdlesfkkqsfvlkegveyrikisfrvnreivsgmkyiqhtyrkgvkidktd
ymvgsygpraeeyefltpveeapkgmlargsysiksrftdddktdhlswewnltikkdwk

SCOP Domain Coordinates for d1cc0e_:

Click to download the PDB-style file with coordinates for d1cc0e_.
(The format of our PDB-style files is described here.)

Timeline for d1cc0e_: