Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (27 families) "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
Family b.1.18.8: RhoGDI-like [81288] (3 proteins) |
Protein Rho GDP-dissociation inhibitor 1, RhoGDI [49241] (3 species) |
Species Human (Homo sapiens) [TaxId:9606] [49242] (12 PDB entries) |
Domain d1cc0e_: 1cc0 E: [21902] Other proteins in same PDB: d1cc0a_, d1cc0c_ complexed with gdp, mg |
PDB Entry: 1cc0 (more details)
SCOPe Domain Sequences for d1cc0e_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cc0e_ b.1.18.8 (E:) Rho GDP-dissociation inhibitor 1, RhoGDI {Human (Homo sapiens) [TaxId: 9606]} svnykppaqksiqeiqeldkddeslrkykeallgrvavsadpnvpnvvvtgltlvcssap gpleldltgdlesfkkqsfvlkegveyrikisfrvnreivsgmkyiqhtyrkgvkidktd ymvgsygpraeeyefltpveeapkgmlargsysiksrftdddktdhlswewnltikkdwk
Timeline for d1cc0e_: