Lineage for d4al2c_ (4al2 C:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1442275Fold d.167: Peptide deformylase [56419] (1 superfamily)
    alpha-beta(5)-alpha; 3 layers: a/b/a; meander beta-sheet wraps around the C-terminal alpha-helix
  4. 1442276Superfamily d.167.1: Peptide deformylase [56420] (2 families) (S)
    nickel-dependent enzyme
  5. 1442277Family d.167.1.1: Peptide deformylase [56421] (2 proteins)
    automatically mapped to Pfam PF01327
  6. 1442391Protein automated matches [190200] (6 species)
    not a true protein
  7. 1442398Species Escherichia coli [TaxId:469008] [194798] (3 PDB entries)
  8. 1442403Domain d4al2c_: 4al2 C: [219018]
    automated match to d4az4a_
    complexed with h2s, ni

Details for d4al2c_

PDB Entry: 4al2 (more details), 2.6 Å

PDB Description: peptide deformylase (ni-form) with hydrosulfide
PDB Compounds: (C:) Peptide deformylase

SCOPe Domain Sequences for d4al2c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4al2c_ d.167.1.1 (C:) automated matches {Escherichia coli [TaxId: 469008]}
svlqvlhipderlrkvakpveevnaeiqrivddmfetmyaeegiglaatqvdihqriivi
dvsenrderlvlinpelleksgetgieegclsipeqralvpraekvkiraldrdgkpfel
eadgllaiciqhemdhlvgklfmdylsplkqqrirqkvekld

SCOPe Domain Coordinates for d4al2c_:

Click to download the PDB-style file with coordinates for d4al2c_.
(The format of our PDB-style files is described here.)

Timeline for d4al2c_: