SCOPe 2.07: Domain d4al2b_: 4al2 B:

Lineage for d4al2b_ (4al2 B:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.167: Peptide deformylase [56419] (1 superfamily)
   alpha-beta(5)-alpha; 3 layers: a/b/a; meander beta-sheet wraps around the C-terminal alpha-helix

4. Superfamily d.167.1: Peptide deformylase [56420] (2 families)
   nickel-dependent enzyme

5. Family d.167.1.1: Peptide deformylase [56421] (2 proteins)
   automatically mapped to Pfam PF01327

6. Protein automated matches [190200] (10 species)
   not a true protein

7. Species Escherichia coli [TaxId:469008] [194798] (3 PDB entries)

8. Domain d4al2b_: 4al2 B: [219017]
   automated match to d4az4a_
   complexed with h2s, ni

Details for d4al2b_

PDB Entry: 4al2, 2.6 Å

PDB Description: peptide deformylase (ni-form) with hydrosulfide

PDB Compounds: (B:) Peptide deformylase

SCOPe Domain Sequences for d4al2b_:

Sequence; same for both SEQRES and ATOM records:

>d4al2b_ d.167.1.1 (B:) automated matches {Escherichia coli [TaxId: 469008]}
svlqvlhipderlrkvakpveevnaeiqrivddmfetmyaeegiglaatqvdihqriivi
dvsenrderlvlinpelleksgetgieegclsipeqralvpraekvkiraldrdgkpfel
eadgllaiciqhemdhlvgklfmdylsplkqqrirqkvekldrlkar

Timeline for d4al2b_:

• d4al2b_ first appeared in SCOPe 2.03
  
• d4al2b_ appears in SCOPe 2.06
  
• d4al2b_ appears in the current release, SCOPe 2.08