Lineage for d1rhoc_ (1rho C:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2038571Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2039078Family b.1.18.8: RhoGDI-like [81288] (3 proteins)
  6. 2039110Protein Rho GDP-dissociation inhibitor 1, RhoGDI [49241] (3 species)
  7. 2039115Species Human (Homo sapiens) [TaxId:9606] [49242] (12 PDB entries)
  8. 2039136Domain d1rhoc_: 1rho C: [21901]
    complexed with so4

Details for d1rhoc_

PDB Entry: 1rho (more details), 2.5 Å

PDB Description: structure of rho guanine nucleotide dissociation inhibitor
PDB Compounds: (C:) rho GDP-dissociation inhibitor 1

SCOPe Domain Sequences for d1rhoc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rhoc_ b.1.18.8 (C:) Rho GDP-dissociation inhibitor 1, RhoGDI {Human (Homo sapiens) [TaxId: 9606]}
vpnvvvtgltlvcssapgpleldltgdlesfkkqsfvlkegveyrikisfrvnreivsgm
kyiehtyrkgvkidktdymvgsygpraeeyefltpveeapkgmlargsysiksrftdddk
tdhlswewnltikkdwk

SCOPe Domain Coordinates for d1rhoc_:

Click to download the PDB-style file with coordinates for d1rhoc_.
(The format of our PDB-style files is described here.)

Timeline for d1rhoc_: