Lineage for d1rhoc_ (1rho C:)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 157352Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
  4. 157353Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 160629Family b.1.1.5: E set domains [49208] (27 proteins)
  6. 160845Protein Rho GDP-dissociation inhibitor 1, RhoGDI [49241] (2 species)
  7. 160850Species Human (Homo sapiens) [TaxId:9606] [49242] (8 PDB entries)
  8. 160857Domain d1rhoc_: 1rho C: [21901]

Details for d1rhoc_

PDB Entry: 1rho (more details), 2.5 Å

PDB Description: structure of rho guanine nucleotide dissociation inhibitor

SCOP Domain Sequences for d1rhoc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rhoc_ b.1.1.5 (C:) Rho GDP-dissociation inhibitor 1, RhoGDI {Human (Homo sapiens)}
vpnvvvtgltlvcssapgpleldltgdlesfkkqsfvlkegveyrikisfrvnreivsgm
kyiehtyrkgvkidktdymvgsygpraeeyefltpveeapkgmlargsysiksrftdddk
tdhlswewnltikkdwk

SCOP Domain Coordinates for d1rhoc_:

Click to download the PDB-style file with coordinates for d1rhoc_.
(The format of our PDB-style files is described here.)

Timeline for d1rhoc_: