![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.18: E set domains [81296] (27 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
![]() | Family b.1.18.8: RhoGDI-like [81288] (3 proteins) |
![]() | Protein Rho GDP-dissociation inhibitor 1, RhoGDI [49241] (3 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [49242] (12 PDB entries) |
![]() | Domain d1rhoc_: 1rho C: [21901] complexed with so4 |
PDB Entry: 1rho (more details), 2.5 Å
SCOPe Domain Sequences for d1rhoc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rhoc_ b.1.18.8 (C:) Rho GDP-dissociation inhibitor 1, RhoGDI {Human (Homo sapiens) [TaxId: 9606]} vpnvvvtgltlvcssapgpleldltgdlesfkkqsfvlkegveyrikisfrvnreivsgm kyiehtyrkgvkidktdymvgsygpraeeyefltpveeapkgmlargsysiksrftdddk tdhlswewnltikkdwk
Timeline for d1rhoc_: