SCOPe 2.05: Domain d4ajra_: 4ajr A:

Lineage for d4ajra_ (4ajr A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily)
   consists of two intertwined (sub)domains related by pseudo dyad; duplication
   3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest

4. Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families)
   the constituent families form similar dimers

5. Family c.77.1.1: Dimeric isocitrate & isopropylmalate dehydrogenases [53660] (4 proteins)
   the active site is between the two identical subunits

6. Protein automated matches [190072] (18 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [193425] (5 PDB entries)

8. Domain d4ajra_: 4ajr A: [219005]
   automated match to d4ajca_
   complexed with akg, mg, nap, nmn; mutant

Details for d4ajra_

PDB Entry: 4ajr, 2.69 Å

PDB Description: 3D structure of E. coli Isocitrate Dehydrogenase K100M mutant in complex with alpha-ketoglutarate, magnesium(II) and NADPH - The product complex

PDB Compounds: (A:) Isocitrate dehydrogenase [NADP]

SCOPe Domain Sequences for d4ajra_:

Sequence; same for both SEQRES and ATOM records:

>d4ajra_ c.77.1.1 (A:) automated matches {Escherichia coli [TaxId: 562]}
eskvvvpaqgkkitlqngklnvpenpiipyiegdgigvdvtpamlkvvdaavekaykger
kiswmeiytgekstqvygqdvwlpaetldlireyrvaimgplttpvgggirslnvalrqe
ldlyiclrpvryyqgtpspvkhpeltdmvifrensediyagiewkadsadaekvikflre
emgvkkirfpehcgigikpcseegtkrlvraaieyaiandrdsvtlvhkgnimkftegaf
kdwgyqlareefggelidggpwlkvknpntgkeivikdviadaflqqillrpaeydviac
mnlngdyisdalaaqvggigiapganigdecalfeathgtapkyagqdkvnpgsiilsae
mmlrhmgwteaadlivkgmegainaktvtydferlmdgakllkcsefgdaiienm

Timeline for d4ajra_:

• d4ajra_ first appeared in SCOPe 2.03
  
• d4ajra_ appears in SCOPe 2.04
  
• d4ajra_ appears in SCOPe 2.06
  
• d4ajra_ appears in the current release, SCOPe 2.08