| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily) unusual fold, defines family |
Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) ![]() |
| Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins) N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain) automatically mapped to Pfam PF02866 |
| Protein automated matches [226882] (10 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [225057] (9 PDB entries) |
| Domain d4ajpc2: 4ajp C:160-331 [219002] Other proteins in same PDB: d4ajpa1, d4ajpb1, d4ajpc1, d4ajpd1 automated match to d9ldta2 complexed with 88n, gol, so4 |
PDB Entry: 4ajp (more details), 2.38 Å
SCOPe Domain Sequences for d4ajpc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ajpc2 d.162.1.1 (C:160-331) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sgcnldsarfrylmgerlgvhplschgwvlgehgdssvpvwsgmnvagvslktlhpdlgt
dkdkeqwkevhkqvvesayeviklkgytswaiglsvadlaesimknlrrvhpvstmikgl
ygikddvflsvpcilgqngisdlvkvtltseeearlkksadtlwgiqkelqf
Timeline for d4ajpc2: