Lineage for d4ajpc1 (4ajp C:1-159)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845793Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2845794Protein automated matches [190069] (319 species)
    not a true protein
  7. 2847056Species Human (Homo sapiens) [TaxId:9606] [186944] (65 PDB entries)
  8. 2847141Domain d4ajpc1: 4ajp C:1-159 [219001]
    Other proteins in same PDB: d4ajpa2, d4ajpb2, d4ajpc2, d4ajpd2
    automated match to d9ldta1
    complexed with 88n, gol, so4

Details for d4ajpc1

PDB Entry: 4ajp (more details), 2.38 Å

PDB Description: Human LDHA in complex with 2-((4-(4-((3-((2-methyl-1,3-benzothiazol- 6yl)amino)-3-oxo-propyl)amino)-4-oxo-butyl)phenyl)methyl)propanedioic acid
PDB Compounds: (C:) L-lactate dehydrogenase A chain

SCOPe Domain Sequences for d4ajpc1:

Sequence, based on SEQRES records: (download)

>d4ajpc1 c.2.1.0 (C:1-159) automated matches {Human (Homo sapiens) [TaxId: 9606]}
atlkdqliynllkeeqtpqnkitvvgvgavgmacaisilmkdladelalvdviedklkge
mmdlqhgslflrtpkivsgkdynvtansklviitagarqqegesrlnlvqrnvnifkfii
pnvvkyspnckllivsnpvdiltyvawkisgfpknrvig

Sequence, based on observed residues (ATOM records): (download)

>d4ajpc1 c.2.1.0 (C:1-159) automated matches {Human (Homo sapiens) [TaxId: 9606]}
atlkdqliynllkqtpqnkitvvgvgavgmacaisilmkdladelalvdviedklkgemm
dlqhgslflrtpkivsgkdynvtansklviitagarqqegesrlnlvqrnvnifkfiipn
vvkyspnckllivsnpvdiltyvawkisgfpknrvig

SCOPe Domain Coordinates for d4ajpc1:

Click to download the PDB-style file with coordinates for d4ajpc1.
(The format of our PDB-style files is described here.)

Timeline for d4ajpc1: