SCOP 1.75: Domain d1rhob_: 1rho B:

Lineage for d1rhob_ (1rho B:)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (23 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.8: RhoGDI-like [81288] (2 proteins)

6. Protein Rho GDP-dissociation inhibitor 1, RhoGDI [49241] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49242] (11 PDB entries)

8. Domain d1rhob_: 1rho B: [21900]

Details for d1rhob_

PDB Entry: 1rho, 2.5 Å

PDB Description: structure of rho guanine nucleotide dissociation inhibitor

PDB Compounds: (B:) rho GDP-dissociation inhibitor 1

SCOP Domain Sequences for d1rhob_:

Sequence; same for both SEQRES and ATOM records:

>d1rhob_ b.1.18.8 (B:) Rho GDP-dissociation inhibitor 1, RhoGDI {Human (Homo sapiens) [TaxId: 9606]}
vavsadpnvpnvvvtgltlvcssapgpleldltgdlesfkkqsfvlkegveyrikisfrv
nreivsgmkyiehtyrkgvkidktdymvgsygpraeeyefltpveeapkgmlargsysik
srftdddktdhlswewnltikkdwk

Timeline for d1rhob_:

• d1rhob_ first appeared (with stable ids) in SCOP 1.55
  
• d1rhob_ appears in SCOP 1.73
  
• d1rhob_ appears in SCOPe 2.01
  
• d1rhob_ appears in the current release, SCOPe 2.08