SCOPe 2.05: Domain d1rhoa_: 1rho A:

Lineage for d1rhoa_ (1rho A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (24 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.8: RhoGDI-like [81288] (3 proteins)

6. Protein Rho GDP-dissociation inhibitor 1, RhoGDI [49241] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49242] (12 PDB entries)

8. Domain d1rhoa_: 1rho A: [21899]
   complexed with so4

Details for d1rhoa_

PDB Entry: 1rho, 2.5 Å

PDB Description: structure of rho guanine nucleotide dissociation inhibitor

PDB Compounds: (A:) rho GDP-dissociation inhibitor 1

SCOPe Domain Sequences for d1rhoa_:

Sequence; same for both SEQRES and ATOM records:

>d1rhoa_ b.1.18.8 (A:) Rho GDP-dissociation inhibitor 1, RhoGDI {Human (Homo sapiens) [TaxId: 9606]}
vavsadpnvpnvvvtgltlvcssapgpleldltgdlesfkkqsfvlkegveyrikisfrv
nreivsgmkyiehtyrkgvkidktdymvgsygpraeeyefltpveeapkgmlargsysik
srftdddktdhlswewnltikkdwk

Timeline for d1rhoa_:

• d1rhoa_ first appeared (with stable ids) in SCOP 1.55
  
• d1rhoa_ appears in SCOPe 2.04
  
• d1rhoa_ appears in SCOPe 2.06
  
• d1rhoa_ appears in the current release, SCOPe 2.08