Lineage for d1rhoa_ (1rho A:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 546418Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 551984Superfamily b.1.18: E set domains [81296] (18 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 552337Family b.1.18.8: RhoGDI-like [81288] (2 proteins)
  6. 552343Protein Rho GDP-dissociation inhibitor 1, RhoGDI [49241] (2 species)
  7. 552352Species Human (Homo sapiens) [TaxId:9606] [49242] (9 PDB entries)
  8. 552359Domain d1rhoa_: 1rho A: [21899]

Details for d1rhoa_

PDB Entry: 1rho (more details), 2.5 Å

PDB Description: structure of rho guanine nucleotide dissociation inhibitor

SCOP Domain Sequences for d1rhoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rhoa_ b.1.18.8 (A:) Rho GDP-dissociation inhibitor 1, RhoGDI {Human (Homo sapiens)}
vavsadpnvpnvvvtgltlvcssapgpleldltgdlesfkkqsfvlkegveyrikisfrv
nreivsgmkyiehtyrkgvkidktdymvgsygpraeeyefltpveeapkgmlargsysik
srftdddktdhlswewnltikkdwk

SCOP Domain Coordinates for d1rhoa_:

Click to download the PDB-style file with coordinates for d1rhoa_.
(The format of our PDB-style files is described here.)

Timeline for d1rhoa_: