SCOP 1.61: Domain d1rhoa_: 1rho A:

Lineage for d1rhoa_ (1rho A:)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.5: E set domains [49208] (27 proteins)

6. Protein Rho GDP-dissociation inhibitor 1, RhoGDI [49241] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49242] (8 PDB entries)

8. Domain d1rhoa_: 1rho A: [21899]

Details for d1rhoa_

PDB Entry: 1rho, 2.5 Å

PDB Description: structure of rho guanine nucleotide dissociation inhibitor

SCOP Domain Sequences for d1rhoa_:

Sequence; same for both SEQRES and ATOM records:

>d1rhoa_ b.1.1.5 (A:) Rho GDP-dissociation inhibitor 1, RhoGDI {Human (Homo sapiens)}
vavsadpnvpnvvvtgltlvcssapgpleldltgdlesfkkqsfvlkegveyrikisfrv
nreivsgmkyiehtyrkgvkidktdymvgsygpraeeyefltpveeapkgmlargsysik
srftdddktdhlswewnltikkdwk

Timeline for d1rhoa_:

• d1rhoa_ first appeared (with stable ids) in SCOP 1.55
  
• d1rhoa_ appears in SCOP 1.59
  
• d1rhoa_ appears in SCOP 1.63
  
• d1rhoa_ appears in the current release, SCOPe 2.08