Lineage for d1rhoa_ (1rho A:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 9579Family b.1.1.5: E set domains [49208] (23 proteins)
  6. 9741Protein Rho GDP-dissociation inhibitor 1, RhoGDI [49241] (2 species)
  7. 9746Species Human (Homo sapiens) [TaxId:9606] [49242] (3 PDB entries)
  8. 9748Domain d1rhoa_: 1rho A: [21899]

Details for d1rhoa_

PDB Entry: 1rho (more details), 2.5 Å

PDB Description: structure of rho guanine nucleotide dissociation inhibitor

SCOP Domain Sequences for d1rhoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rhoa_ b.1.1.5 (A:) Rho GDP-dissociation inhibitor 1, RhoGDI {Human (Homo sapiens)}
vavsadpnvpnvvvtgltlvcssapgpleldltgdlesfkkqsfvlkegveyrikisfrv
nreivsgmkyiehtyrkgvkidktdymvgsygpraeeyefltpveeapkgmlargsysik
srftdddktdhlswewnltikkdwk

SCOP Domain Coordinates for d1rhoa_:

Click to download the PDB-style file with coordinates for d1rhoa_.
(The format of our PDB-style files is described here.)

Timeline for d1rhoa_: