Lineage for d4ajnc2 (4ajn C:160-331)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1938734Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 1938735Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 1938736Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins)
    N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
    automatically mapped to Pfam PF02866
  6. 1939065Protein automated matches [226882] (7 species)
    not a true protein
  7. 1939107Species Norway rat (Rattus norvegicus) [TaxId:10116] [226330] (13 PDB entries)
  8. 1939150Domain d4ajnc2: 4ajn C:160-331 [218986]
    Other proteins in same PDB: d4ajna1, d4ajnb1, d4ajnc1, d4ajnd1
    automated match to d9ldta2
    complexed with 88v, gol

Details for d4ajnc2

PDB Entry: 4ajn (more details), 2.1 Å

PDB Description: rat ldha in complex with 2-((4-(2-((3-((2-methyl-1,3-benzothiazol-6- yl)amino)-3-oxo-propyl)carbamoylamino)ethyl)phenyl)methyl) propanedioic acid
PDB Compounds: (C:) L-lactate dehydrogenase A chain

SCOPe Domain Sequences for d4ajnc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ajnc2 d.162.1.1 (C:160-331) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
sgcnldsarfrylmgerlgvhplschgwvlgehgdssvpvwsgvnvagvslkslnpqlgt
dadkeqwkdvhkqvvdsayeviklkgytswaiglsvadlaesimknlrrvhpistmikgl
ygikedvflsvpcilgqngisdvvkvtltpdeearlkksadtlwgiqkelqf

SCOPe Domain Coordinates for d4ajnc2:

Click to download the PDB-style file with coordinates for d4ajnc2.
(The format of our PDB-style files is described here.)

Timeline for d4ajnc2: