SCOPe 2.01: Domain d1ds6b_: 1ds6 B:

Lineage for d1ds6b_ (1ds6 B:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (24 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.8: RhoGDI-like [81288] (3 proteins)

6. Protein Rho GDP-dissociation inhibitor 1, RhoGDI [49241] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49242] (11 PDB entries)

8. Domain d1ds6b_: 1ds6 B: [21898]
   Other proteins in same PDB: d1ds6a_
   complex with rac (chain B)
   complexed with gdp, mg

Details for d1ds6b_

PDB Entry: 1ds6, 2.35 Å

PDB Description: crystal structure of a rac-rhogdi complex

PDB Compounds: (B:) rho GDP-dissociation inhibitor 2

SCOPe Domain Sequences for d1ds6b_:

Sequence; same for both SEQRES and ATOM records:

>d1ds6b_ b.1.18.8 (B:) Rho GDP-dissociation inhibitor 1, RhoGDI {Human (Homo sapiens) [TaxId: 9606]}
gnykpppqkslkelqemdkddeslikykktllgdgpvvtdpkapnvvvtrltlvcesapg
pitmdltgdlealkketivlkegseyrvkihfkvnrdivsglkyvqhtyrtgvkvdkatf
mvgsygprpeeyefltpveeapkgmlargtyhnksfftdddkqdhlswewnlsikkewg

Timeline for d1ds6b_:

• d1ds6b_ first appeared (with stable ids) in SCOP 1.55
  
• d1ds6b_ appears in SCOP 1.75
  
• d1ds6b_ appears in SCOPe 2.02
  
• d1ds6b_ appears in the current release, SCOPe 2.08