Class b: All beta proteins [48724] (144 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (18 families) "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
Family b.1.18.8: RhoGDI-like [81288] (2 proteins) |
Protein Rho GDP-dissociation inhibitor 1, RhoGDI [49241] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [49242] (9 PDB entries) |
Domain d1ds6b_: 1ds6 B: [21898] Other proteins in same PDB: d1ds6a_ complex with rac (chain B) |
PDB Entry: 1ds6 (more details), 2.35 Å
SCOP Domain Sequences for d1ds6b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ds6b_ b.1.18.8 (B:) Rho GDP-dissociation inhibitor 1, RhoGDI {Human (Homo sapiens)} gnykpppqkslkelqemdkddeslikykktllgdgpvvtdpkapnvvvtrltlvcesapg pitmdltgdlealkketivlkegseyrvkihfkvnrdivsglkyvqhtyrtgvkvdkatf mvgsygprpeeyefltpveeapkgmlargtyhnksfftdddkqdhlswewnlsikkewg
Timeline for d1ds6b_: