Lineage for d1ds6b_ (1ds6 B:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 9579Family b.1.1.5: E set domains [49208] (23 proteins)
  6. 9741Protein Rho GDP-dissociation inhibitor 1, RhoGDI [49241] (2 species)
  7. 9746Species Human (Homo sapiens) [TaxId:9606] [49242] (3 PDB entries)
  8. 9747Domain d1ds6b_: 1ds6 B: [21898]
    Other proteins in same PDB: d1ds6a_

Details for d1ds6b_

PDB Entry: 1ds6 (more details), 2.35 Å

PDB Description: crystal structure of a rac-rhogdi complex

SCOP Domain Sequences for d1ds6b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ds6b_ b.1.1.5 (B:) Rho GDP-dissociation inhibitor 1, RhoGDI {Human (Homo sapiens)}
gnykpppqkslkelqemdkddeslikykktllgdgpvvtdpkapnvvvtrltlvcesapg
pitmdltgdlealkketivlkegseyrvkihfkvnrdivsglkyvqhtyrtgvkvdkatf
mvgsygprpeeyefltpveeapkgmlargtyhnksfftdddkqdhlswewnlsikkewg

SCOP Domain Coordinates for d1ds6b_:

Click to download the PDB-style file with coordinates for d1ds6b_.
(The format of our PDB-style files is described here.)

Timeline for d1ds6b_: