Lineage for d1ds6b_ (1ds6 B:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. Superfamily b.1.18: E set domains [81296] (27 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. Family b.1.18.8: RhoGDI-like [81288] (3 proteins)
  6. Protein Rho GDP-dissociation inhibitor 1, RhoGDI [49241] (3 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [49242] (12 PDB entries)
  8. Domain d1ds6b_: 1ds6 B: [21898]
    Other proteins in same PDB: d1ds6a_
    complex with rac (chain B)
    complexed with gdp, mg

Details for d1ds6b_

PDB Entry: 1ds6 (more details), 2.35 Å

PDB Description: crystal structure of a rac-rhogdi complex
PDB Compounds: (B:) rho GDP-dissociation inhibitor 2

SCOPe Domain Sequences for d1ds6b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ds6b_ b.1.18.8 (B:) Rho GDP-dissociation inhibitor 1, RhoGDI {Human (Homo sapiens) [TaxId: 9606]}
gnykpppqkslkelqemdkddeslikykktllgdgpvvtdpkapnvvvtrltlvcesapg
pitmdltgdlealkketivlkegseyrvkihfkvnrdivsglkyvqhtyrtgvkvdkatf
mvgsygprpeeyefltpveeapkgmlargtyhnksfftdddkqdhlswewnlsikkewg

SCOPe Domain Coordinates for d1ds6b_ are not available.

Timeline for d1ds6b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1ds6a_