| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
| Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
| Protein automated matches [190069] (319 species) not a true protein |
| Species Norway rat (Rattus norvegicus) [TaxId:10116] [226329] (13 PDB entries) |
| Domain d4ajld1: 4ajl D:1-159 [218979] Other proteins in same PDB: d4ajla2, d4ajlb2, d4ajlc2, d4ajld2 automated match to d9ldta1 complexed with 88w, dms, gol, mli |
PDB Entry: 4ajl (more details), 1.77 Å
SCOPe Domain Sequences for d4ajld1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ajld1 c.2.1.0 (D:1-159) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
aalkdqlivnllkeeqvpqnkitvvgvgavgmacaisilmkdladelalvdviedklkge
mmdlqhgslflktpkivsskdysvtansklviitagarqqegesrlnlvqrnvnifkfii
pnvvkyspqckllivsnpvdiltyvawkisgfpknrvig
Timeline for d4ajld1: