SCOPe 2.06: Domain d4ajjb1: 4ajj B:2-159

Lineage for d4ajjb1 (4ajj B:2-159)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (239 species)
   not a true protein

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [226329] (13 PDB entries)

8. Domain d4ajjb1: 4ajj B:2-159 [218959]
   Other proteins in same PDB: d4ajja2, d4ajjb2, d4ajjc2, d4ajjd2
   automated match to d9ldta1
   complexed with 88r, 88s, dms, gol, mli

Details for d4ajjb1

PDB Entry: 4ajj, 1.75 Å

PDB Description: rat ldha in complex with 2-((3,4-dimethoxyphenyl)methyl))propanedioic acid and n-(2-methyl-1,3-benzothiazol-6-yl)-3-ureido-propanamide

PDB Compounds: (B:) L-lactate dehydrogenase A chain

SCOPe Domain Sequences for d4ajjb1:

Sequence; same for both SEQRES and ATOM records:

>d4ajjb1 c.2.1.0 (B:2-159) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
alkdqlivnllkeeqvpqnkitvvgvgavgmacaisilmkdladelalvdviedklkgem
mdlqhgslflktpkivsskdysvtansklviitagarqqegesrlnlvqrnvnifkfiip
nvvkyspqckllivsnpvdiltyvawkisgfpknrvig

Timeline for d4ajjb1:

• d4ajjb1 first appeared in SCOPe 2.03
  
• d4ajjb1 appears in SCOPe 2.05
  
• d4ajjb1 appears in SCOPe 2.07
  
• d4ajjb1 appears in the current release, SCOPe 2.08