SCOPe 2.03: Domain d4ajha1: 4ajh A:1-159

Lineage for d4ajha1 (4ajh A:1-159)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (159 species)
   not a true protein

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [226329] (12 PDB entries)

8. Domain d4ajha1: 4ajh A:1-159 [218941]
   Other proteins in same PDB: d4ajha2, d4ajhb2, d4ajhc2, d4ajhd2
   automated match to d9ldta1
   complexed with 2b4, 88s, gol, mli

Details for d4ajha1

PDB Entry: 4ajh, 1.93 Å

PDB Description: rat ldha in complex with n-(2-methyl-1,3-benzothiazol-6-yl)-3-ureido- propanamide and 2-(4-bromophenoxy)propanedioic acid

PDB Compounds: (A:) L-lactate dehydrogenase A chain

SCOPe Domain Sequences for d4ajha1:

Sequence, based on SEQRES records:

>d4ajha1 c.2.1.0 (A:1-159) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
aalkdqlivnllkeeqvpqnkitvvgvgavgmacaisilmkdladelalvdviedklkge
mmdlqhgslflktpkivsskdysvtansklviitagarqqegesrlnlvqrnvnifkfii
pnvvkyspqckllivsnpvdiltyvawkisgfpknrvig

Sequence, based on observed residues (ATOM records):

>d4ajha1 c.2.1.0 (A:1-159) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
aalkdqlivnllkvpqnkitvvgvgavgmacaisilmkdladelalvdviedklkgemmd
lqhgslflktpkivsskdysvtansklviitagarqqegesrlnlvqrnvnifkfiipnv
vkyspqckllivsnpvdiltyvawkisgfpknrvig

Timeline for d4ajha1:

• d4ajha1 is new in SCOPe 2.03-stable
  
• d4ajha1 appears in SCOPe 2.04
  
• d4ajha1 appears in the current release, SCOPe 2.08