Lineage for d4ajha1 (4ajh A:1-159)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2426096Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2426097Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2430344Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2430345Protein automated matches [190069] (243 species)
    not a true protein
  7. 2431835Species Norway rat (Rattus norvegicus) [TaxId:10116] [226329] (13 PDB entries)
  8. 2431852Domain d4ajha1: 4ajh A:1-159 [218941]
    Other proteins in same PDB: d4ajha2, d4ajhb2, d4ajhc2, d4ajhd2
    automated match to d9ldta1
    complexed with 2b4, 88s, gol, mli

Details for d4ajha1

PDB Entry: 4ajh (more details), 1.93 Å

PDB Description: rat ldha in complex with n-(2-methyl-1,3-benzothiazol-6-yl)-3-ureido- propanamide and 2-(4-bromophenoxy)propanedioic acid
PDB Compounds: (A:) L-lactate dehydrogenase A chain

SCOPe Domain Sequences for d4ajha1:

Sequence, based on SEQRES records: (download)

>d4ajha1 c.2.1.0 (A:1-159) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
aalkdqlivnllkeeqvpqnkitvvgvgavgmacaisilmkdladelalvdviedklkge
mmdlqhgslflktpkivsskdysvtansklviitagarqqegesrlnlvqrnvnifkfii
pnvvkyspqckllivsnpvdiltyvawkisgfpknrvig

Sequence, based on observed residues (ATOM records): (download)

>d4ajha1 c.2.1.0 (A:1-159) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
aalkdqlivnllkvpqnkitvvgvgavgmacaisilmkdladelalvdviedklkgemmd
lqhgslflktpkivsskdysvtansklviitagarqqegesrlnlvqrnvnifkfiipnv
vkyspqckllivsnpvdiltyvawkisgfpknrvig

SCOPe Domain Coordinates for d4ajha1:

Click to download the PDB-style file with coordinates for d4ajha1.
(The format of our PDB-style files is described here.)

Timeline for d4ajha1: