Lineage for d1qfha2 (1qfh A:750-857)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 788950Superfamily b.1.18: E set domains [81296] (23 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 789498Family b.1.18.10: Filamin repeat (rod domain) [81290] (4 proteins)
    Pfam PF00630
  6. 789499Protein F-actin cross-linking gelation factor (ABP-120) repeats [49239] (1 species)
  7. 789500Species Dictyostelium discoideum [TaxId:44689] [49240] (3 PDB entries)
    Uniprot P13466 547-857
  8. 789502Domain d1qfha2: 1qfh A:750-857 [21894]
    Rod domains 5 and 6

Details for d1qfha2

PDB Entry: 1qfh (more details), 2.2 Å

PDB Description: dimerization of gelation factor from dictyostelium discoideum: crystal structure of rod domains 5 and 6
PDB Compounds: (A:) protein (gelation factor)

SCOP Domain Sequences for d1qfha2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qfha2 b.1.18.10 (A:750-857) F-actin cross-linking gelation factor (ABP-120) repeats {Dictyostelium discoideum [TaxId: 44689]}
gangedssfgsftftvaaknkkgevktyggdkfevsitgpaeeitldaidnqdgtytaay
slvgngrfstgvklngkhiegspfkqvlgnpgkknpevksftttrtan

SCOP Domain Coordinates for d1qfha2:

Click to download the PDB-style file with coordinates for d1qfha2.
(The format of our PDB-style files is described here.)

Timeline for d1qfha2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1qfha1